{
  "docId": "019de50f-5497-72a6-9a31-629b074fd38e",
  "docSlug": "f65a1e09f8cd0fc1385a9214a72d1895",
  "documentTitle": "DeepMind | Product Presentation Deck | 55 slides",
  "authorId": "deepmind",
  "authorName": "DeepMind",
  "documentKindSlug": "conference-presentation",
  "documentKindLabel": "Conference presentation",
  "sourceTypeSlug": "investor_relations",
  "sourceTypeLabel": "Investor relations",
  "presentationDate": "2019-03-01 00:00:00",
  "orientation": "landscape",
  "aspectRatio": 1.681261,
  "pageNumber": 39,
  "pageCount": 55,
  "prevPage": 38,
  "nextPage": 40,
  "slideType": "other",
  "function": "establish_context",
  "density": "balanced",
  "nDataPoints": 0,
  "notes": "The slide uses a simple process flow to define a biological concept.",
  "elementsJson": null,
  "metadataConfidence": 0.9,
  "imagePath": null,
  "slideHref": "/slides/019de50f-5497-72a6-9a31-629b074fd38e/39",
  "deckHref": "/decks/019de50f-5497-72a6-9a31-629b074fd38e",
  "deckJsonHref": "/decks/019de50f-5497-72a6-9a31-629b074fd38e.json",
  "deckAnchorHref": "/decks/019de50f-5497-72a6-9a31-629b074fd38e#slide-39",
  "components": [
    {
      "bbox": {
        "h": 0.07,
        "w": 0.27,
        "x": 0.09,
        "y": 0.23
      },
      "kind": "callout",
      "text": "Amino acid sequence",
      "attrs": null,
      "subkind": "primary",
      "toolName": null,
      "toolSlug": null,
      "confidence": null,
      "componentId": "9e5a84fb-ffad-47a4-9fe7-87b267441718",
      "frameworkName": null,
      "frameworkSlug": null
    },
    {
      "bbox": {
        "h": 0.07,
        "w": 0.27,
        "x": 0.63,
        "y": 0.23
      },
      "kind": "callout",
      "text": "3D protein structure",
      "attrs": null,
      "subkind": "primary",
      "toolName": null,
      "toolSlug": null,
      "confidence": null,
      "componentId": "d9c53dec-4d4d-4013-8c94-ab7897820b9f",
      "frameworkName": null,
      "frameworkSlug": null
    },
    {
      "bbox": {
        "h": 0.12,
        "w": 0.11,
        "x": 0.45,
        "y": 0.53
      },
      "kind": "diagram",
      "text": null,
      "attrs": null,
      "subkind": "process",
      "toolName": null,
      "toolSlug": null,
      "confidence": null,
      "componentId": "1e34b13d-18ab-4dd5-9cc2-d6a2e9ed0bc5",
      "frameworkName": null,
      "frameworkSlug": null
    },
    {
      "bbox": {
        "h": 0.52,
        "w": 0.27,
        "x": 0.63,
        "y": 0.35
      },
      "kind": "image",
      "text": "Hemoglobin",
      "attrs": null,
      "subkind": "illustration",
      "toolName": null,
      "toolSlug": null,
      "confidence": null,
      "componentId": "8e840fbf-9b0e-44fb-a0cd-4b0ea3aa38c5",
      "frameworkName": null,
      "frameworkSlug": null
    },
    {
      "bbox": {
        "h": 0.25,
        "w": 0.38,
        "x": 0.07,
        "y": 0.49
      },
      "kind": "paragraph",
      "text": "VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR",
      "attrs": null,
      "subkind": "paragraph",
      "toolName": null,
      "toolSlug": null,
      "confidence": null,
      "componentId": "c57336a3-4377-4232-b78d-8c0d5640ed29",
      "frameworkName": null,
      "frameworkSlug": null
    },
    {
      "bbox": {
        "h": 0.06,
        "w": 0.44,
        "x": 0.28,
        "y": 0.06
      },
      "kind": "title",
      "text": "What is protein folding?",
      "attrs": null,
      "subkind": "headline",
      "toolName": null,
      "toolSlug": null,
      "confidence": null,
      "componentId": "74738656-cf8c-48b6-b902-2ca55f8f85f4",
      "frameworkName": null,
      "frameworkSlug": null
    }
  ],
  "metrics": [],
  "tools": [
    {
      "name": "Audience Definition",
      "slug": "audience-definition",
      "agent": "Storyteller",
      "layer": "slide",
      "matchId": "d368aab2-6f98-4578-988e-7f11b71be066",
      "evidence": "paragraph/paragraph: VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSHGSAQVKGHGKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR",
      "confidence": 0.7
    }
  ],
  "frameworks": [],
  "arcBeats": [],
  "loops": [
    {
      "to": 49,
      "from": 38,
      "name": "The Reveal",
      "slug": "05-the-reveal",
      "bestFor": "Product launches, strategic pivots, unexpected findings",
      "matchId": "c9871ca7-bf4c-407b-930e-ad5ed7ae4cdf",
      "evidence": "Detailed explanation of AlphaFold's technology and results",
      "position": 2,
      "objective": "Revealing the capabilities of AlphaFold",
      "structure": "Setup the Question -> Build Suspense -> The Big Reveal",
      "confidence": 0.8,
      "description": "Build mystery and anticipation, then deliver a surprising or powerful conclusion"
    }
  ],
  "imagePathAlt": null,
  "thumbSrc": null,
  "thumbSrcAlt": null,
  "locked": true
}